Monoclonal Anti-CNR1 antibody produced in mouse clone 2F9, purified immunoglobulin, buffered aqueous solution

  • Monoclonal Anti-CNR1 antibody produced in mouse clone 2F9, purified immunoglobulin, buffered aqueous solution
  • Monoclonal Anti-CNR1 antibody produced in mouse clone 2F9, purified immunoglobulin, buffered aqueous solution
  • Monoclonal Anti-CNR1 antibody produced in mouse clone 2F9, purified immunoglobulin, buffered aqueous solution
  • Description

    Monoclonal Anti-CNR1 antibody produced in mouse clone 2F9, purified immunoglobulin, buffered aqueous solution

    Synonym(s):
    Anti-CB1K5, Anti-CNR, Anti-CB1A, Anti-CBR, Anti-CANN6, Anti-cannabinoid receptor 1 (brain), Anti-CB1
    NACRES:
    NA.41

    Quality Level

    100

    biological source

    mouse

    antibody form

    purified immunoglobulin

    antibody product type

    primary antibodies

    clone

    2F9, monoclonal

    form

    buffered aqueous solution

    species reactivity

    human

    application(s)

    indirect ELISA: suitable
    western blot: 1-5 μg/mL

    isotype

    IgG2bκ

    conjugate

    unconjugated

    GenBank® accession no.

    NM_016083

    UniProt accession no.

    P21554

    shipped in

    dry ice

    storage temp.

    −20°C

    Gene Information

    human ... CNR1(1268)

    This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. (provided by RefSeq)
    Cannabinoid receptor 1 (CNR1) also known as the type-1 cannabinoid receptor (CB1), is encoded by the gene mapped to human chromosome 6q15. The encoded protein is a member of the class A G protein-coupled receptor (GPCR) family and is highly expressed in the brain and the central nervous system.

    Immunogen

    CNR1 (NP_057167, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence
    MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV

    Biochem/physiol Actions

    Cannabinoid receptor 1 (CNR1) plays a key role in regulation of the endocannabinoid system (ECS), which is involved in most of the activities of the brain and body. Mutations in the gene has been associated with the development of hebephrenic schizophrenia. Experimental studies hypothesize that aberrations in CNR1 gene increases the risk of susceptibility to substance abuse.

    Physical form

    Solution in phosphate buffered saline, pH 7.4

    Legal Information

    GenBank is a registered trademark of United States Department of Health and Human Services

    Disclaimer

    Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

    SAFETY INFORMATION

    Personal Protective Equipment

    dust mask type N95 (US),Eyeshields,Gloves

    RIDADR

    NONH for all modes of transport

    Flash Point(F)

    Not applicable

    Flash Point(C)

    Not applicable